PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009151020.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family CO-like
Protein Properties Length: 392aa    MW: 42795 Da    PI: 5.5052
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009151020.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box21.54.9e-074678436
        zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg 36
                    + C+ +++  + l+C+ +  +lC +C ++ H  
  XP_009151020.1 46 KLCDSCKSATAALYCRPDAAFLCLSCDSKVHAA 78
                    58***************************9954 PP

2zf-B_box27.37.5e-0988133342
        zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                      ++C+ +e+ +++  C+ +   lC +C   +H+       H++vp+
  XP_009151020.1  88 VWMCEVCEQAPAHVTCKADAAALCVTCDRDIHSAnplarrHERVPV 133
                     689*****************************66899999999986 PP

3CCT69.86.9e-24324367144
             CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                     Rea+++RY+eKrk+RkFeK+irY+sRKa+Ae RpR+KGrF+k++
  XP_009151020.1 324 REARVMRYREKRKNRKFEKTIRYASRKAYAEMRPRIKGRFAKRT 367
                     9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011910.4384390IPR000315B-box-type zinc finger
SMARTSM003364.2E-134390IPR000315B-box-type zinc finger
PfamPF006433.6E-54685IPR000315B-box-type zinc finger
CDDcd000217.79E-94790No hitNo description
PROSITE profilePS5011910.89386133IPR000315B-box-type zinc finger
PfamPF006433.8E-788133IPR000315B-box-type zinc finger
CDDcd000218.71E-1089133No hitNo description
SMARTSM003361.3E-1091133IPR000315B-box-type zinc finger
PfamPF062037.9E-18324366IPR010402CCT domain
PROSITE profilePS5101716.767324366IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 392 aa     Download sequence    Send to blast
MGTTWIDSWT SSCEAISSPT TKTEXQIERE RSEKREKXRE REMASKLCDS CKSATAALYC  60
RPDAAFLCLS CDSKVHAANK LASRHARVWM CEVCEQAPAH VTCKADAAAL CVTCDRDIHS  120
ANPLARRHER VPVTPFYDSV SDSDGSAKHA AVNFLDDCYF SDLDGNASRE EEDEAASWLL  180
PNPKTTTAVA TAAEAVPGDS PEMNTGQQYL FPDLDLDYGT VDPKVETQEQ NSSGTDGVVP  240
VENRTVKVAT VNENCYELDF TGGSKGFTYG YNSISHSVSS SSLEVGVVPD GGSVADVSYP  300
YGGAATSVTD PGTQRAVPLT AAEREARVMR YREKRKNRKF EKTIRYASRK AYAEMRPRIK  360
GRFAKRTDTN DSNDVVVGHG GIFSGFGLVP TF
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009151020.10.0PREDICTED: LOW QUALITY PROTEIN: zinc finger protein CONSTANS-LIKE 4
SwissprotQ940T90.0COL4_ARATH; Zinc finger protein CONSTANS-LIKE 4
TrEMBLM4D0080.0M4D008_BRARP; Uncharacterized protein
STRINGBra009805.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM27602765
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24930.10.0CONSTANS-like 4